FGA


Also found in: Medical.
AcronymDefinition
FGAField Goals Attempted (basketball statistic)
FGAFujitsu General America (energy systems)
FGAFonds de Garantie Automobile (French: Motor Guarantee Fund; Luxembourg)
FGAFirst-Generation Antipsychotic
FGAFast Genetic Algorithm
FGAFormation Générale des Adultes (French: General Education for Adults; Canada)
FGAFamily Guidance Association
FGAFiat Group Automobiles
FGAFood Grinder Attachment
FGAFlower Growers Association (various locations)
FGAFibrinogen, A alpha polypeptide
FGAFeature Group A
FGAFuturegen Alliance
FGAFull Gospel Assembly
FGAFlorida Geographic Alliance
FGAFamily Gamers Alliance
FGAFinnish Greenkeepers' Association (golf)
FGAFighter Ground Attack
FGAFeel Good Anyway (Portland, OR)
FGAFundo de Garantia Automóvel (Portugese: Motor Vehicle Guarantee Fund)
FGAFort Greely, Alaska
FGAFlorida Guides Association
FGAFat Girl Angle (pictures)
FGAFédération de Grimpe d'Arbres (French: Tree Climbing Federation)
FGAFrequently Given Answer
FGAFine-Grained Authorization (software)
FGAFunky Green Aliens (Belgium)
FGAFabrice Gallon Automobiles (French car company)
FGAFondo Giovani Artisti (Italian: Young Artists Fund)
FGAFree Grace Alliance (Tomball, TX)
FGAFree Game Arts
FGAFlorida Greyhound Association
FGAFantasy Golf Association
FGAFellow, Gemological Association of Great Britain
FGAFrank Giannantonio Associates Inc.
FGAFree-Space Green's Function Approach
FGAFinal Goods Audit
References in periodicals archive ?
He alleged that leaders of FGA received huge amount from the political agents and distributed the same among themselves rather than proposing solid suggestions for the future of Fata.
4 Currently, the pathogenesis of congenital dysfibrinogenemia is contributed to mutations in the three genes which encode fibrinogen together, that are genes FGA, FGB and FGG.
These are the targets Welsh Government and the legislation such as the FGA seeks to construction to deliver against and not to just aspire to.
These are the targets the Welsh Government and legislation such as the FGA seek construction to deliver and not to just aspire to.
Addressing a press conference here at Peshawar Press Club, Malik Khan Marjan chief pattern FGA along with Malik Bahadar Shah of Bajaur Agency, Malik Naib Khan of FR Kohat, Malik Haji Shahi Baz of Khyber Agency, Saeed Ullah of Mohmand Agency and others said that Fata has 20 million population and they have own rights so the issues should be discussed before a decision is taken.
Andrew Fellows FGA DGA is the online distance learning tuition manager, and a gemmology and diamond tutor, at Gem-A in London.
When Vita et al (2) analyzed FGA--and SGA-treated patients separately, however, they found a significant reduction in cortical gray matter in the FGA group but not in the SGA group.
FGA is accredited by Chartered Institute for Securities & Investments (CISI) - UK, City & Guilds - UK and Institute of Certified Management Accountants (ICMA) -the Management Accounting body in Sri Lanka.
The FGA revealed mild to moderate gait impairments with a median of 22(12,31) for the men PPV and 23(11, 30) for women PPV.
LC-MS/MS showed the amino acid sequence of the 4210 m/z peptide as IMSEYLWDPERRMFLARTGQSWSLILLIYFFFY, a fragment of ATP1B4; and the 5904 m/z peptide sequence as SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSE ADHEGTHSTKRGHAKSRPV, which is a fragment of the fibrinogen alpha (FGA) isoform 1/2 of the FGA chain precursor.
El experimento se llevo a cabo en primavera (mayo), todas las ovejas fueron sometidas a un programa de sincronizacion de estros durante 12 dias, para lo cual, se colocaron intravaginalmente esponjas de poliuretano impregnadas con 40 mg de FGA, y 24 h antes de la remocion de las esponjas, se administro aleatoriamente via intramuscular uno de cuatro tratamientos (T1=testigo; T2=200 UI de PMSG; T3=300 UI de PMSG; y T4=400 UI de PMSG).
which owns 50% of FGA Capital through its subsidiary Fiat Group