FGF2


Also found in: Medical.
AcronymDefinition
FGF2Fibroblast Growth Factor 2
References in periodicals archive ?
She also collected visceral fat tissue from women undergoing hysterectomies and found that when the fat secretions had more of the FGF2 protein, more of the cells formed cancerous tumors when transferred into mice.
Maturation of sheep oocytes improved the following supplementation of the medium with FGF2 (43).
FGF2, 145 amino acid residues: PALPEDGGA AFPPGHFKDPKRLYCKNGGFFLRIHPDGRVD GVREKSDPHVKLQLQAEERGVVSIKGVCAN RYLAMKEDGRLLASKCVTEECFFFERLESN NYNTYRSRKYSSWYVALKRTGQYKLGSKT GPGQKAILFLPMSAKS;
FGF2 is also thought to protect neurons from free radicals, nitric oxide, excitatory amino acids, hypoglycaemia, hypoxia and ischaemia.
Reprogramming in NME7-AB is 50-100 times more efficient than reprogramming in FGF2 based media and does not require feeder cells.
The first split on the survival tree was FGF2 rs167428, indicating that this SNP is the primary factor contributing to overall survival.
Corticosterone (green hexagons), a glucocorticoid hormone related to stress, stimulates astrocytes to release FGF2, which triggers the generation of new neurons from neural stem cells.
They traced the effect to excessively high levels of FGF2 (fibroblast growth factor 2) - a protein that stimulates cells to divide.
Cells were exposed to chemicals for 48 hr in N2 medium containing epidermal growth factor (EGF) (20 ng/mL) and FGF2 (20 ng/mL).
Mitogen-activated protein kinases ERK 1/2- and p38-GATA4 pathways mediate the Ang II-induced activation of FGF2 gene in neonatal rat cardiomyocytes.