FGF9


Also found in: Medical.
AcronymDefinition
FGF9Fibroblast Growth Factor 9 (glia-activating factor)
References in periodicals archive ?
Fibroblast growth factor (FGF) 2 and FGF9 mediate mesenchymal-epithelial interactions of peritubular and Sertoli cells in the rat testis.
Flechas indican regulacion morfogenetica de DHH, PDGFA, activina A, FGF2 y FGF9.
FGF9, 205 amino acid residues: VGSYFGVQD AVPFGNVPVLPVDSPVLLSDHLGQSEAGGLP RGPAVTDLDHLKGILRRRQLYCRTGFHLEIF PNGTIQGTRKDHSRFGILEFISIAVGLVSIRGV DSGLYLGMNEKGELYGSEKLTQECVFREQF EENWYNTYSSNLYKHVDTGRRYYVALNKD GTPREGTRTKRHQKFTHFLPRPVDPDKVPEL YKDILSQS.
To confirm if the gene products are associated with transition of the endometrium to refractory in vivo, recombinant FGF2 and FGF9 proteins (rFGF2 and rFGF9, respectively) were administered to DI mice and LE cell proliferation was analyzed after administration.
En las personas con depresion se encontro aumento de la produccion de FGF9 en el hipocampo (estructura cerebral clave para la memoria, el aprendizaje y el estres social); en tanto que en los cerebros sin depresion la concentracion fue normal.
FGF20 and FGF9 are members of a family of proteins known as fibroblast growth factors.
Using two different transgenic Cre mouse lines that induce either a temporal or a cell-specific ablation of this receptor reveal that FGFR2 mediated FGF9 signaling is essential for proliferation and Sertoli differentiation during testis determination (16).
Of interest, the expression levels of FGFI, FGFS, and FGF9 mRNA in the cornea were consistently lower than the corresponding levels in the retina.
When nearby cells were exposed to estrogen, they secreted 14 times more FGF9, a signaling protein that drives CSC proliferation.
Molecular genetic screening of MBS1 locus on chromosome 13 for microdeletions and exclusion of FGF9, GSH1 and CDX2 as causative genes in patients with Mobius Sybdrome.
Also showing significant associations with ovarian cancer were variants in 6 other genes, including FGFR1, FGFR2, FGF7, FGF9 (fibroblast growth factor 9), FGF10 (fibroblast growth factor 10), and FGF14.