FGF9


Also found in: Medical.
AcronymDefinition
FGF9Fibroblast Growth Factor 9 (glia-activating factor)
Copyright 1988-2018 AcronymFinder.com, All rights reserved.
References in periodicals archive ?
Zhang et al., "Fgf9 from dermal [gamma][delta] T cells induces hair follicle neogenesis after wounding," Nature Medicine, vol.
Fibroblast growth factor (FGF) 2 and FGF9 mediate mesenchymal-epithelial interactions of peritubular and Sertoli cells in the rat testis.
FGF9, 205 amino acid residues: VGSYFGVQD AVPFGNVPVLPVDSPVLLSDHLGQSEAGGLP RGPAVTDLDHLKGILRRRQLYCRTGFHLEIF PNGTIQGTRKDHSRFGILEFISIAVGLVSIRGV DSGLYLGMNEKGELYGSEKLTQECVFREQF EENWYNTYSSNLYKHVDTGRRYYVALNKD GTPREGTRTKRHQKFTHFLPRPVDPDKVPEL YKDILSQS.
FGF9 was also up-regulated by the combination of all four plant extracts suggesting an increase in osteoblast proliferation and bone formation (Behr et al.
For example, SRGN inhibited the growth of hydroxyapatite crystals [50]; PTHLH and FGF9 inhibited terminal differentiation of chondrocytes and mineralization [51-53]; mutation of ANKH caused chondrocalcinosis [54, 55]; CTGF-treated mesenchymal stem cells (MSCs) lost the ability to differentiate into chondrocytes and osteoblasts [56]; EGFR signaling suppressed osteoblast differentiation [57, 58]; and PTGER4 mediated the inhibition of mineralization in mature cementoblasts by prostaglandin E2 [59].
Capel, "FGF9 promotes survival of germ cells in the fetal testis," Development, vol.
When this growth factor, called Fgf9, was overexpressed in a mouse model, there was a two- to three-fold increase in the number of new hair follicles produced.
Shh expression occurs downstream of Fgf8 and Fgf9, is regulated by Bmp4, and is responsible for regulating Bmp2 [Zhao et al., 2000; Thesleff et al., 2001].
In the presence of the two proteins, FGF9 and FGF20, mouse kidney stem cells stayed alive outside the body longer than previously reported.
Scientists used a natural chemical called fibroblast growth factor 9 (FGF9) to stimulate the support cells in mice.
Geoffrey Pickering and Matthew Frontini at the Schulich School of Medicine & Dentistry of the University of Western Ontario developed a strategy in which a biological factor, called fibroblast growth factor 9 (FGF9), is delivered at the same time that the body is making its own effort at forming new blood vessels in vulnerable or damaged tissue.